DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and astl3c

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002937470.2 Gene:astl3c / 100491451 XenbaseID:XB-GENE-22069695 Length:533 Species:Xenopus tropicalis


Alignment Length:272 Identity:87/272 - (31%)
Similarity:118/272 - (43%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLAGIFAPNLVASEGIESYE-NYYNEIHID--DEQAEAKTRN---------------ALTSPLQR 56
            |..||.|...:..|..:|.. |...|..:|  .:.|||...|               :.||....
 Frog    29 LADGITASKEILEENKKSGPGNKKPESSVDVFTQIAEANKGNMALTEGGDILINIGRSATSSDYL 93

  Fly    57 WP----GNKIL-YRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKR----YVSFKKS 112
            ||    |..:: |..|.:||..|:...:|||..|...|||:|     .|...:|    .||....
 Frog    94 WPKSADGTVVVPYIFSYNYSADELTLFKTAMQEFETLTCVRF-----VPKTIQRDFLNIVSNGGC 153

  Fly   113 PNMCGTRVGYQPL---SFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQIDYDN 174
            .:|.|...|.|.:   |:|         |::. .|||||..|.||.:||..|.|||:||.|..:|
 Frog   154 LSMVGRNGGGQKVELASYG---------CMSR-GVIQHELNHALGFYHEHMRSDRDDYVTIITEN 208

  Fly   175 IPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQVRGPSE 239
            |...| ..:.:..:|....:.|||.||||||:|.|:..|.|.||   :........:||..|.|.
 Frog   209 IIPSY-ENYFSKRKTNNMGIIYDYNSVMHYSRNTFSISPDKSTI---VPKPDPSIPIGQRDGLSI 269

  Fly   240 GDWTKIRLMYKC 251
            .|..||:.:|:|
 Frog   270 LDILKIKKLYQC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 71/207 (34%)
ZnMc_astacin_like 59..249 CDD:239807 68/197 (35%)
astl3cXP_002937470.2 ZnMc 99..281 CDD:381785 69/200 (35%)
CUB 290..393 CDD:366096
CUB 398..508 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.