DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and astl3b.2

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031746779.1 Gene:astl3b.2 / 100491112 XenbaseID:XB-GENE-22069683 Length:529 Species:Xenopus tropicalis


Alignment Length:225 Identity:73/225 - (32%)
Similarity:101/225 - (44%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KTRNALTSPLQRWP----GNKIL-YRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGK 104
            |.|:|:......||    |..|: |..|::||..::|..::.|..:...|||:|     .|.|.:
 Frog   104 KGRSAMNCTECLWPKSTDGTVIVPYNFSSNYSADQLALFKSTMQEYESLTCVRF-----VPRANE 163

  Fly   105 RYVSFKKSPNMCGT---RVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDE 166
            .......|.|.|.:   :||      |...|.|:........:||||..|.||.:|||||.|||:
 Frog   164 TDFLSIVSDNGCASFLGKVG------GDQTVQLDSYGCIYRGIIQHELNHALGFYHEQSRSDRDD 222

  Fly   167 YVQIDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAK----------DPSKPTIRAL 221
            ||.|..:||...|...|...| :....:.|||.|||||..:||:|          ||:.|     
 Frog   223 YVTIHTENIIPGYEGNFNKAD-SNNLGLEYDYSSVMHYPGDAFSKNGNLTIVPKPDPTVP----- 281

  Fly   222 IGGKAVEREMGQVRGPSEGDWTKIRLMYKC 251
                     :||..|.|..|.:||..:|:|
 Frog   282 ---------IGQRDGLSILDVSKINRLYQC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 69/213 (32%)
ZnMc_astacin_like 59..249 CDD:239807 66/203 (33%)
astl3b.2XP_031746779.1 ZnMc_hatching_enzyme 121..302 CDD:239810 67/206 (33%)
CUB 306..414 CDD:238001
CUB 419..527 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.