DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6974 and XB5949052

DIOPT Version :9

Sequence 1:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002932488.2 Gene:XB5949052 / 100489456 XenbaseID:XB-GENE-5949053 Length:453 Species:Xenopus tropicalis


Alignment Length:213 Identity:64/213 - (30%)
Similarity:99/213 - (46%) Gaps:18/213 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KTRNALTSPLQRWPGN-----KILYRISTDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGK 104
            |:.|.....:..||.:     :|.|.||:|||....|..:.:...|.:.||::.     .|...:
 Frog    75 KSANTCPKGICLWPKSSDGLVRIPYVISSDYSSYSNALFQASFKGFADTTCIRL-----VPRTSE 134

  Fly   105 R-YVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYV 168
            . |:|| :|.|.|.:.:|   .:.|...|.:.:......::|:||.:|.|||.||..|.|||:||
 Frog   135 TDYLSF-ESLNGCWSPIG---RTGGAQTVSVQQSGCMWTSIIEHEIIHSLGLHHEHVRSDRDKYV 195

  Fly   169 QIDYDNIPRKYWSQFMAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQ 233
            .:.::||.......|...|........|||.|:||||..||:.:.:.||:.|:.....   ..|.
 Frog   196 SVQWNNISPGNTGNFQMTDTNNMNLTKYDYNSLMHYSSTAFSINGNLPTLIAVPDSSV---SFGN 257

  Fly   234 VRGPSEGDWTKIRLMYKC 251
            ....|:.|..|:..:|||
 Frog   258 AFMMSDLDIKKLNTLYKC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6974NP_650414.1 Astacin 55..251 CDD:279708 60/201 (30%)
ZnMc_astacin_like 59..249 CDD:239807 57/195 (29%)
XB5949052XP_002932488.2 ZnMc 92..275 CDD:412141 58/194 (30%)
CUB 342..452 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.