DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and Mrpl1

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_444388.2 Gene:Mrpl1 / 94061 MGIID:2137202 Length:336 Species:Mus musculus


Alignment Length:183 Identity:37/183 - (20%)
Similarity:67/183 - (36%) Gaps:58/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TVELQIG-LRDYDPDKCKRFHGSVLLHHLAVPQL-KVCVFGDQ-------EHCYKAKAIGVDCLD 86
            |:::.:| .:..:|     |...:.|.||...:: ||.||...       |....|.|.|.|   
Mouse   131 TLDMALGKKKTVEP-----FASVIALPHLFSSEVNKVAVFTANASEIKIAEENGAAFAGGTD--- 187

  Fly    87 VEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLAR----------- 140
              .:||:..|..:.       |.::|       :|.::|.        |.||.:           
Mouse   188 --LVKKIMDDEVVV-------DFYVA-------VPEIMGE--------LNPLRKKLKKRFPKATR 228

  Fly   141 ---GESMSSKIKILSTKKKHM---KRMECLSVNVGHVGMHPEELARNIAISIN 187
               |..:...:::..|..:.|   :|...||..:..:.|..:::|.|:...||
Mouse   229 NSIGRDIPKMLELFKTAHEIMVDEERQNFLSTKIATLDMPSDQIAANLQAVIN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 37/183 (20%)
Mrpl1NP_444388.2 Ribosomal_L1 102..244 CDD:381945 27/144 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.