DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and RPL1A

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_015104.1 Gene:RPL1A / 855881 SGDID:S000006141 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:104/217 - (47%)
Similarity:149/217 - (68%) Gaps:2/217 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSKVSRDTIYVAVKNIL-LNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKV 65
            :||::...:...||.:| .:::.|..:.|||||||:||::|||.:.|||.||:.|.:...|.:.:
Yeast     1 MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSI 65

  Fly    66 CVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTN 130
            |:|||.....:||:.|||.:.|:.||||||:.||.|||||.|:.|:|||.:|||:||||||.|:.
Yeast    66 CIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSK 130

  Fly   131 AGKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLK 194
            ||||.||::..:.:..|: .:.||.|..:|::.||:|.||:|.|..:.|...|.:|:||.|||||
Yeast   131 AGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLK 195

  Fly   195 DNWQNVRSLHIKSSLGVPHQLY 216
            .|||||.||.:|||:|...:||
Yeast   196 KNWQNVGSLVVKSSMGPAFRLY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 102/214 (48%)
RPL1ANP_015104.1 Ribosomal_L1 1..217 CDD:412308 102/215 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346603
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9189
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.