DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and AT1G08360

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_563813.2 Gene:AT1G08360 / 837356 AraportID:AT1G08360 Length:216 Species:Arabidopsis thaliana


Alignment Length:216 Identity:107/216 - (49%)
Similarity:160/216 - (74%) Gaps:1/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKVC 66
            :||:..:.:..|:..|...|:||..:.:||:||||||::|||.|.|||.|||.|.|:..|::|:|
plant     1 MSKLQSEAVREAITTITGKSEAKKRNFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKIC 65

  Fly    67 VFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTNA 131
            :.||.:|..:|:.:|::.:|||:||||||:.||.|||:|.|..||||||:||||||||||||..|
plant    66 MLGDAQHVEEAEKMGLENMDVESLKKLNKNKKLVKKLAKKYHAFLASESVIKQIPRLLGPGLNKA 130

  Fly   132 GKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKD 195
            |||.|.::..||:.||: :..:|.|..:|::.|:.|.||::.|..:::.:|:.:|:||||||||.
plant   131 GKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKK 195

  Fly   196 NWQNVRSLHIKSSLGVPHQLY 216
            ||||||.|::||::|.|.:::
plant   196 NWQNVRCLYLKSTMGPPQRIF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 107/213 (50%)
AT1G08360NP_563813.2 Ribosomal_L1 1..216 CDD:412308 107/214 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.