DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and AT5G22440

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001078612.1 Gene:AT5G22440 / 832305 AraportID:AT5G22440 Length:217 Species:Arabidopsis thaliana


Alignment Length:217 Identity:106/217 - (48%)
Similarity:161/217 - (74%) Gaps:2/217 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSKVSRDTIYVAVKNILLN-SQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKV 65
            :||:..:.:..|:.:|:.: .:.|..:..||:||||||::|||.|.|||.|||.|.|:..|::|:
plant     1 MSKLQSEAVREAISSIITHCKETKPRNFTETIELQIGLKNYDPQKDKRFSGSVKLPHVPRPKMKI 65

  Fly    66 CVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTN 130
            |:.||.:|..:|:.||::.:||||||||||:.||.|||:|.:..||||||:||||||||||||..
plant    66 CMLGDAQHVEEAEKIGLESMDVEALKKLNKNKKLVKKLAKKFHAFLASESVIKQIPRLLGPGLNK 130

  Fly   131 AGKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLK 194
            ||||.|.::..||:.||: :..:|.|..:|::.|:.|.||::.|..:::.:|:.:|:||||||||
plant   131 AGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLK 195

  Fly   195 DNWQNVRSLHIKSSLGVPHQLY 216
            .||||||.|::||::|.|::::
plant   196 KNWQNVRCLYLKSTMGPPNRVF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 106/214 (50%)
AT5G22440NP_001078612.1 Ribosomal_L1 1..217 CDD:412308 106/215 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.