Sequence 1: | NP_650410.1 | Gene: | RpL10Aa / 41811 | FlyBaseID: | FBgn0038281 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001191062.1 | Gene: | mrpl1 / 553284 | ZFINID: | ZDB-GENE-060526-311 | Length: | 316 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 47/207 - (22%) |
---|---|---|---|
Similarity: | 79/207 - (38%) | Gaps: | 32/207 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLR-DYDPDKCKRFHGSVLLHHLAVPQL- 63
Fly 64 ---KVCVF---GDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPR 122
Fly 123 LLGPGLTNAGKFLTPLAR----GESMSSKIKILSTKKKHMKRMECLSVNVGHVGMHPEELARNIA 183
Fly 184 ISINFLVSLLKD 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpL10Aa | NP_650410.1 | Ribosomal_L1 | 3..216 | CDD:294228 | 45/205 (22%) |
mrpl1 | NP_001191062.1 | Ribosomal_L1 | 98..241 | CDD:294228 | 35/155 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0081 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |