DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and RPL10A

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_009035.3 Gene:RPL10A / 4736 HGNCID:10299 Length:217 Species:Homo sapiens


Alignment Length:217 Identity:126/217 - (58%)
Similarity:162/217 - (74%) Gaps:1/217 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKV 65
            |.|||||||:|.||:.:|..:|.|....||||||||.|::|||.|.|||.|:|.|.....|:..|
Human     1 MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSV 65

  Fly    66 CVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTN 130
            ||.|||:||.:|||:.:..:|:||||||||:.||.|||:|.||.||||||:||||||:|||||..
Human    66 CVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNK 130

  Fly   131 AGKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLK 194
            ||||.:.|...|:|.:|: ::.||.|..||::.||:|.||||.|..:||..||.:::||||||||
Human   131 AGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLK 195

  Fly   195 DNWQNVRSLHIKSSLGVPHQLY 216
            .||||||:|:|||::|.|.:||
Human   196 KNWQNVRALYIKSTMGKPQRLY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 123/213 (58%)
RPL10ANP_009035.3 Ribosomal_L1 2..217 CDD:412308 123/214 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.