DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and rpl10a

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_955930.1 Gene:rpl10a / 323305 ZFINID:ZDB-GENE-030131-2025 Length:216 Species:Danio rerio


Alignment Length:216 Identity:125/216 - (57%)
Similarity:160/216 - (74%) Gaps:1/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKVC 66
            :|||||||:|.|||.:...|:.|....||||||||.|::|||.|.|||.|:|.|.....|:..||
Zfish     1 MSKVSRDTLYEAVKEVQAGSRRKKRKFLETVELQISLKNYDPQKDKRFSGTVRLKTTPRPKFSVC 65

  Fly    67 VFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTNA 131
            |.|||:||.:|||..:..:|:||||||||:.||.|||:|.||.||||||:||||||:|||||..|
Zfish    66 VLGDQQHCDEAKAAELPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKA 130

  Fly   132 GKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKD 195
            |||.:.|...|::.:|: ::.||.|..||::.||:|.||||.|..|||..||.:::||||||||.
Zfish   131 GKFPSLLTHNENLGTKVDEVKSTIKFQMKKVLCLAVAVGHVKMSEEELVYNIHLAVNFLVSLLKK 195

  Fly   196 NWQNVRSLHIKSSLGVPHQLY 216
            ||||||:|:|||::|.|.:||
Zfish   196 NWQNVRALYIKSTMGKPQRLY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 123/213 (58%)
rpl10aNP_955930.1 Ribosomal_L1 1..216 CDD:294228 123/214 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.