DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and RpL7A

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001284944.1 Gene:RpL7A / 31588 FlyBaseID:FBgn0014026 Length:271 Species:Drosophila melanogaster


Alignment Length:128 Identity:26/128 - (20%)
Similarity:44/128 - (34%) Gaps:49/128 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLARGESMS----SKIKI 150
            |:|...:..|.|||.            :|:|.....     .||.:.|..:...:|    :..|:
  Fly   104 LEKYRPESPLAKKLR------------LKKIAEAKA-----KGKDVEPKKKPSYVSAGTNTVTKL 151

  Fly   151 LSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKDNWQNVRSLHIKSSLGVPH 213
            :..||..:       |.:.| .:.|.||       :.||.:|.:             .:|||:
  Fly   152 IEQKKAQL-------VVIAH-DVDPLEL-------VLFLPALCR-------------KMGVPY 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 26/128 (20%)
RpL7ANP_001284944.1 PTZ00365 18..271 CDD:240382 26/128 (20%)
Ribosomal_L7Ae 37..257 CDD:294400 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.