DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and RGD1566137

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_217361.5 Gene:RGD1566137 / 301299 RGDID:1566137 Length:217 Species:Rattus norvegicus


Alignment Length:217 Identity:125/217 - (57%)
Similarity:160/217 - (73%) Gaps:1/217 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKV 65
            |.|||||||:|.||:.:|..:|.|....||||||||.|::|||.|.|||.|:|.|.....|:..|
  Rat     1 MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSV 65

  Fly    66 CVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTN 130
            ||.|||:||.:|||:.:..:|:||||||||:.||.|||.|.||.||||||:||||||:|||||..
  Rat    66 CVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLDKKYDGFLASESLIKQIPRILGPGLNK 130

  Fly   131 AGKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLK 194
            ||||.:.|...|:|.:|: ::.||.|..||::.||:|.|||:.|..:||..||.:::||||||||
  Rat   131 AGKFPSLLTHNENMVAKVDEVKSTIKFQMKKLLCLAVAVGHMKMTDDELVYNIHLAVNFLVSLLK 195

  Fly   195 DNWQNVRSLHIKSSLGVPHQLY 216
            .||||||:|:|||::|.|..||
  Rat   196 KNWQNVRALYIKSTMGKPQHLY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 122/213 (57%)
RGD1566137XP_217361.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.