DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and rpl102

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_596267.1 Gene:rpl102 / 2540378 PomBaseID:SPBC30D10.18c Length:216 Species:Schizosaccharomyces pombe


Alignment Length:216 Identity:111/216 - (51%)
Similarity:154/216 - (71%) Gaps:1/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKVC 66
            :||||...|..:|:.||..|:.|..:..|||||||||::|||.:.|||.|::.|.::..|.:.:|
pombe     1 MSKVSPANIRSSVETILKGSEEKKRNFTETVELQIGLKNYDPQRDKRFSGTIKLPNVPRPNMSIC 65

  Fly    67 VFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTNA 131
            :.||.....:||..|||.:.|:.||||||:.||.|||:|.||.|:|||.:||||||||||||:.|
pombe    66 ILGDAHDLDRAKHGGVDAMSVDDLKKLNKNKKLVKKLAKKYDAFIASEVLIKQIPRLLGPGLSKA 130

  Fly   132 GKFLTPLARGESMSSK-IKILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKD 195
            |||.:|::..:.:..| |::.||.|..:|::.||.|.||||.|..|:||.|::::|||||||||.
pombe   131 GKFPSPVSHSDDLYGKIIEVKSTIKFQLKKVLCLGVAVGHVDMAEEQLAANLSLAINFLVSLLKK 195

  Fly   196 NWQNVRSLHIKSSLGVPHQLY 216
            .|||:.||.|||::|.|::||
pombe   196 GWQNIGSLVIKSTMGKPYRLY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 109/213 (51%)
rpl102NP_596267.1 PTZ00029 1..216 CDD:185405 109/214 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9287
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.