DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and rpl-1

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_491061.1 Gene:rpl-1 / 171853 WormBaseID:WBGene00004412 Length:216 Species:Caenorhabditis elegans


Alignment Length:216 Identity:122/216 - (56%)
Similarity:158/216 - (73%) Gaps:1/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKVC 66
            :|||||:::..|:..:|..|..|.....||:||||||::|||.|.|||.||:.|.|:..|.:|||
 Worm     1 MSKVSRESLNEAIAEVLKGSSEKPRKFRETIELQIGLKNYDPQKDKRFSGSIRLKHIPRPNMKVC 65

  Fly    67 VFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTNA 131
            |||||.|..:|.|..:..:..:.||||||..||.|||:|:||.|:||||:||||||:|||||..|
 Worm    66 VFGDQHHLDEAAAGDIPSMSADDLKKLNKQKKLIKKLAKSYDAFIASESLIKQIPRILGPGLNKA 130

  Fly   132 GKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLKD 195
            |||.:.:..|||:.||. :|.:|.|..||::.||||.|||||:..|||..||::||||||||||.
 Worm   131 GKFPSVVTHGESLQSKSDEIRATVKFQMKKVLCLSVAVGHVGLTQEELVSNISLSINFLVSLLKK 195

  Fly   196 NWQNVRSLHIKSSLGVPHQLY 216
            ||||||||:|||::|.|.::|
 Worm   196 NWQNVRSLNIKSTMGKPQRVY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 121/213 (57%)
rpl-1NP_491061.1 Ribosomal_L1 1..216 CDD:294228 121/214 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.