DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL10Aa and LOC103690888

DIOPT Version :9

Sequence 1:NP_650410.1 Gene:RpL10Aa / 41811 FlyBaseID:FBgn0038281 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_008771696.1 Gene:LOC103690888 / 103690888 RGDID:9343299 Length:217 Species:Rattus norvegicus


Alignment Length:208 Identity:114/208 - (54%)
Similarity:150/208 - (72%) Gaps:1/208 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVSKVSRDTIYVAVKNILLNSQAKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKV 65
            |.|||||||:|.||:.:|..::.|....|:.|||||.|::|.|.|.|||.|::.|......:..|
  Rat     1 MSSKVSRDTLYKAVQEVLYGNRCKRCKFLDMVELQISLKNYHPQKDKRFSGTIRLKSTPCSKFSV 65

  Fly    66 CVFGDQEHCYKAKAIGVDCLDVEALKKLNKDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTN 130
            ||.|||:||.:|||:.:..:|:||||||||:.||.|||:|.|||||||||:||||||:|||||..
  Rat    66 CVLGDQQHCDEAKAVDIPAMDIEALKKLNKNKKLVKKLAKKYDVFLASESLIKQIPRILGPGLNK 130

  Fly   131 AGKFLTPLARGESMSSKI-KILSTKKKHMKRMECLSVNVGHVGMHPEELARNIAISINFLVSLLK 194
            .|||.:.|...|:|.:|: |:.||.|..||::..|:|.||||.|...||..||.:::||||||||
  Rat   131 VGKFPSLLTHNENMVAKVDKVKSTIKFQMKKVLRLAVAVGHVNMTNGELVYNIHLAVNFLVSLLK 195

  Fly   195 DNWQNVRSLHIKS 207
            .||||:::|:|||
  Rat   196 KNWQNLQALYIKS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL10AaNP_650410.1 Ribosomal_L1 3..216 CDD:294228 113/206 (55%)
LOC103690888XP_008771696.1 Ribosomal_L1 2..208 CDD:412308 111/205 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62172
OrthoDB 1 1.010 - - D1172076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100869
Panther 1 1.100 - - O PTHR23105
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.