DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and Efhd1

DIOPT Version :9

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_083165.1 Gene:Efhd1 / 98363 MGIID:1921607 Length:240 Species:Mus musculus


Alignment Length:153 Identity:53/153 - (34%)
Similarity:76/153 - (49%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 SEDSDCDYELS--LDEVHQR---------FSAW-----FNQKEIDTAYSCFTQMDEDLDGYISLG 227
            |.||:.:.:||  || :||.         |:.:     |:::.:......|...|...||:|.|.
Mouse    51 SADSELNLKLSRRLD-IHQGTARPGRSKVFNPYTEFPEFSRRLLKDLEKMFKTYDAGRDGFIDLM 114

  Fly   228 ELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHALLIYGTVLNRLELRKGHLL-DRERLRL 291
            |||..:|||..|||||..|:::..|..:...:|:|...|||:.      :...|.|. |...|.|
Mouse   115 ELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFH------KAAAGELQEDSGLLAL 173

  Fly   292 ARSKAVDVSKVGVSGAKQFFEAK 314
            |:...:||:..||.|||.|||||
Mouse   174 AKFSEIDVALEGVRGAKNFFEAK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
Efhd1NP_083165.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..54 1/2 (50%)
EFh 95..153 CDD:238008 21/57 (37%)
EF-hand_7 96..153 CDD:290234 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836982
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.