DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and EFHD1

DIOPT Version :9

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_079478.1 Gene:EFHD1 / 80303 HGNCID:29556 Length:239 Species:Homo sapiens


Alignment Length:116 Identity:44/116 - (37%)
Similarity:62/116 - (53%) Gaps:7/116 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 FNQKEIDTAYSCFTQMDEDLDGYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHA 265
            |:::.|....|.|...|...||:|.|.|||..:|||..|||||..|:::..|..:...:|:|...
Human    87 FSRRLIKDLESMFKLYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIKEVDEDFDGKLSFREF 151

  Fly   266 LLIYGTVLNRLELRKGHLL-DRERLRLARSKAVDVSKVGVSGAKQFFEAKI 315
            |||:.      :...|.|. |...:.||:...:||:..||.|||.|||||:
Human   152 LLIFH------KAAAGELQEDSGLMALAKLSEIDVALEGVKGAKNFFEAKV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
EFHD1NP_079478.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
EFh 94..152 CDD:238008 22/57 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.