DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and efhd2

DIOPT Version :9

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001313422.1 Gene:efhd2 / 571114 ZFINID:ZDB-GENE-060531-152 Length:233 Species:Danio rerio


Alignment Length:209 Identity:69/209 - (33%)
Similarity:97/209 - (46%) Gaps:41/209 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 TVTSEDSDCDYEL----SLDE---VHQR-----FSAW-----FNQKEIDTAYSCFTQMDEDLDGY 223
            |.:|.||:...:|    .|:|   .||:     |:.:     |::|:|......|.|.|.:.|.|
Zfish    40 TTSSADSELGAKLQRRGELNEGVGEHQQPSMKVFNPYTEFKEFSRKQIKDMEKMFKQYDSEKDNY 104

  Fly   224 ISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHALLIYGTVLNRLELRK---GHLLD 285
            |.|.|||..:|||..|||||..||::..|..:...:|:|...|||:         ||   |.|.:
Zfish   105 IDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDLDGKLSFREFLLIF---------RKAAAGELAE 160

  Fly   286 RERLR-LARSKAVDVSKVGVSGAKQFFEAKIAMQSDPLPPINSDQPVARIAVHSLN-----TENP 344
            ...|. |||...:|||..||.|||.|||||:...::      |::..|.|.:....     .|..
Zfish   161 DSGLHVLARLSEIDVSTEGVKGAKSFFEAKVQAINE------SNRFEAEIRLEQEEKKKQAEEKK 219

  Fly   345 GRRVNFKSAAALFK 358
            .|:..||...:.||
Zfish   220 QRQAAFKELKSAFK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
efhd2NP_001313422.1 EFh 89..147 CDD:238008 23/57 (40%)
EF-hand_7 90..147 CDD:290234 23/56 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.