DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and efhd1

DIOPT Version :9

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_989300.1 Gene:efhd1 / 394919 XenbaseID:XB-GENE-5738953 Length:236 Species:Xenopus tropicalis


Alignment Length:165 Identity:55/165 - (33%)
Similarity:75/165 - (45%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 FNQKEIDTAYSCFTQMDEDLDGYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHA 265
            |::|:|....:.|.:.|...||:|.:.|||..:|||..|||||..||::..|..:...:|.|...
 Frog    84 FSRKQIKDMEAMFKKYDSGKDGFIDMMELKFLMEKLGAPQTHLGLKNMIKEVDEDFDNKLNFREF 148

  Fly   266 LLIY-GTVLNRLELRKGHLLDRERLRLARSKAVDVSKVGVSGAKQFFEAKIAMQSDPLPPINSDQ 329
            |||: ......||...|      .|.||:...:||...||.|||.|||||:...|      :|.:
 Frog   149 LLIFHKAAAGELEEDSG------LLALAKLSEIDVDVEGVKGAKNFFEAKVQALS------SSSK 201

  Fly   330 PVARIAVHS-----LNTENPGRRVNFKSAAALFKK 359
            ..|.|....     ...|...||..||...:.|.:
 Frog   202 FEAEIRAEQEERKRQEEEKKNRRAAFKELKSAFNQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
efhd1NP_989300.1 EFh 91..149 CDD:238008 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.