DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14861 and Efhd2

DIOPT Version :9

Sequence 1:NP_650409.1 Gene:CG14861 / 41810 FlyBaseID:FBgn0038280 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_080270.2 Gene:Efhd2 / 27984 MGIID:106504 Length:240 Species:Mus musculus


Alignment Length:169 Identity:59/169 - (34%)
Similarity:80/169 - (47%) Gaps:27/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 FNQKEIDTAYSCFTQMDEDLDGYISLGELKRFLEKLEMPQTHLATKNVMTHVVGNHLERLTFCHA 265
            |::|:|......|.|.|...||:|.|.|||..:|||..|||||..|:::..|..:...:|:|...
Mouse    89 FSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREF 153

  Fly   266 LLIYGTVLNRLELRK---GHLLDRERLR-LARSKAVDVSKVGVSGAKQFFEAKIAMQSDPLPPIN 326
            |||:         ||   |.|.:...|. |||...:|||..||.|||.|||||:       ..||
Mouse   154 LLIF---------RKAAAGELQEDSGLHVLARLSEIDVSTEGVKGAKNFFEAKV-------QAIN 202

  Fly   327 SDQPVARIAVHSLNTENPGRR---VNFKSAAALFKKLEN 362
                |:......:..|...|:   ...|...|.||:|::
Mouse   203 ----VSSRFEEEIKAEQEERKKQAEEVKQRKAAFKELQS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14861NP_650409.1 None
Efhd2NP_080270.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
EFh 96..154 CDD:238008 22/57 (39%)
EF-hand_7 97..154 CDD:290234 22/56 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836984
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3918
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1511376at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13025
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.760

Return to query results.
Submit another query.