DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdr and Eph

DIOPT Version :9

Sequence 1:NP_001287331.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_524625.3 Gene:Eph / 43803 FlyBaseID:FBgn0025936 Length:1096 Species:Drosophila melanogaster


Alignment Length:697 Identity:129/697 - (18%)
Similarity:217/697 - (31%) Gaps:234/697 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   341 DLEVLQDCVTINGSLTIELTNIKEKIVDALENAL----ASVKE--------------------IT 381
            |.:|..|.:....|....||::....:.||::|.    |.:.|                    |:
  Fly    10 DKKVKYDGIKSKTSSVTILTSVLNDAISALKSAFYKNQAPISEQNRSQIVSRMSLLRTILLIIIS 74

  Fly   382 GYLKVIHSAQLMSL---------------------------TFLQNLDAIRGDKLVENKYALYVV 419
            .:.|:.|:.|::.|                           :|...:..|.....|....|.:.|
  Fly    75 IHFKLAHADQVVLLDTTREATLEWTRYPYGPQAQTPGWVEESFTDFVKGINWRSYVVCDVAYHNV 139

  Fly   420 NNYHLEHIWPP-------NHLVI-IQ---RGTLFFHLNPRLCYEKI------------------- 454
            ||:    :|.|       |.|.| ||   |....|..|...|.|..                   
  Fly   140 NNW----LWSPFIDRGSANRLYIEIQFTIRDCSLFPGNALSCKETFSLLFYEFDAATREPPPWQT 200

  Fly   455 --HQLQGSLKSGE-----------NISVADVSPNSNGERVIC---GDAVRSLNPKVEDLNSTAVR 503
              ::|...:.:||           |..|..::.|..|.....   |..:..|..||..:...|| 
  Fly   201 DSYRLIARIAAGEGRFNQNSDVDINTEVKSIAVNKKGVYFAFRDQGACISVLAVKVYYITCPAV- 264

  Fly   504 IILDYMDWEGMETLIGYSYHYKEAPV-QNVTMYDGRHGCGHDNWLMDVVPNQSRRHVISGLKPYT 567
                      .|...    |:.|.|. :.:|:.:.::|...||    ..|.::..::..|...:|
  Fly   265 ----------TENFA----HFNETPTGREITIIEKQNGTCVDN----AEPYETPTYLCKGDGKWT 311

  Fly   568 ------------QYAYFVKTLTRTEYHIQIDAYSKIGYFQT------LPDRPSPVLRIYGS--SE 612
                        :..|..||.|.          ..:|.|::      .|..|:......||  .:
  Fly   312 ILTGGCRCKAGYEPNYTNKTCTE----------CPLGTFKSPEVTKCTPCPPNSNASKTGSPFCK 366

  Fly   613 ISSQILLH---------WWPPRRPNGV----------IKNYFVTAEKYNATKEAKDKNYVNVELE 658
            .:|....|         :.||..|..:          |.::...|:..:.:.|...|.|   ..:
  Fly   367 CASGFYRHPNDGRHMPCYSPPAAPTNLTLLFVDQTSAIISWSAPAKNESFSSETNSKIY---HSD 428

  Fly   659 NAKDIDCE-CAGVLPYYSGPQPDDEDYYNKEQITYEDALPNLIY---------VSRNHDYRRKEF 713
            ....|.|. |:..:.|  .|..|.   :|:.:||..:..|...|         ||..::::|...
  Fly   429 IVYKIKCNICSPNVVY--NPSTDT---FNETKITLTNLEPVTTYTVQIHAINSVSHINEFKRHSN 488

  Fly   714 EK--------VINYEHLLSIKKDEEPTRPPT-----TTPAPTNATLAKERLAAINYENYRLNSEK 765
            |.        |.:...||:|..|....:...     ||.:...:|:...|:.||..::..|..:|
  Fly   489 ESSLVAVSDIVFSNTSLLNIPLDLNEVKTGQAEIVFTTESVLLSTVFNLRILAITNKDADLEWDK 553

  Fly   766 KQRDLQDLDQHKYTIRHALPKCQNSHASVVQQVEEKCVAEEPLSGYELPGTQHFYCLSQLEPETH 830
            ..:  .|.....|.:|. .||           ||...:.:..|:..|...    :.:..|| .|.
  Fly   554 PVQ--SDFPLEFYEVRW-FPK-----------VELDAINKSALNTKETKA----HIVGLLE-NTE 599

  Fly   831 YRITIRACVEGVVNGCSTPAEAV----------IKTASIQLERFIKG 867
            |...:|....   ||..:.:..:          :...|:|: |||.|
  Fly   600 YGFQVRCKTN---NGFGSYSNMIYAQTLQSVGSVYDDSVQI-RFIAG 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382
Furin-like 209..332 CDD:279142
Recep_L_domain 347..461 CDD:279382 34/196 (17%)
FN3 491..578 CDD:214495 18/99 (18%)
EphNP_524625.3 EphR_LBD 85..260 CDD:198439 31/178 (17%)
FN3 387..476 CDD:238020 18/96 (19%)
FN3 536..623 CDD:238020 21/108 (19%)
EphA2_TM 644..736 CDD:291255
PTKc_EphR 736..1002 CDD:270629
Pkinase_Tyr 741..999 CDD:285015
SAM_1 1033..1092 CDD:278937
SAM 1039..1092 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.