DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdr and Pvr

DIOPT Version :9

Sequence 1:NP_001287331.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001162911.1 Gene:Pvr / 34127 FlyBaseID:FBgn0032006 Length:1577 Species:Drosophila melanogaster


Alignment Length:567 Identity:103/567 - (18%)
Similarity:184/567 - (32%) Gaps:197/567 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 FVETV---DWIYLMGNATRQHFSLKHNRPQSQCPLCGSLSADFEFIRNSSERCWNVNTTQLRPQP 224
            :||:|   :|.....:..|...|.....|::               |||:.:......|.|..||
  Fly   356 YVESVYGMEWFTPSRDENRIFASQSRTDPKT---------------RNSTHQTGRSTLTVLNAQP 405

  Fly   225 PRLKDCPIACGLNGCDSAGKCCDHNCVTGCYSQNCSLCANYQGRMGCVNQCVASYELNKRRCIGH 289
            .       ..||           :.|||...|......|.|:.::...|:   || ||.....||
  Fly   406 S-------DTGL-----------YKCVTTDNSNQNVQRATYRIKVLKQNE---SY-LNVGEPSGH 448

  Fly   290 RECRELGRIPL-----IRGYQC------------VKKCPGNQK----EILVAKGIIHCQVECNGD 333
            ...:|.....:     ..|:..            |::...|.|    |:.....:::.|::.:|.
  Fly   449 YNVQEYANRTIQMTANFEGFPTPSFSWFKPDGTEVRQSENNFKILSTELSTMLQVLNAQLQDSGT 513

  Fly   334 FHVKSAADLEVLQDCVTINGSLTIELTNIKEKIVDALENALASVKEITGYLKVIHSAQLMSLTFL 398
            :.::.:....|:|....::             ::||     .::|....|::|...|:|      
  Fly   514 YVLRGSNSFGVVQREYNVS-------------VMDA-----PALKMSDAYVQVGSVARL------ 554

  Fly   399 QNLDAIRGDKLVENKYALYVVNNY----HLEHIWP------PNHLVIIQRGTLFFHLNPR---LC 450
                     :.....|...:|..:    .||..||      .|..:..::....|...||   |.
  Fly   555 ---------ECTVRSYPPAIVTFFFRPCSLEPQWPTCSVLNQNFSLPSEQEKYQFQTRPRPGKLS 610

  Fly   451 YEKIHQLQGSLKSGENISVADVSP---NSNGERVICGDAVRSLNPKVEDLNSTAVRIILDYMDWE 512
            .|:|::          :|.....|   ....:.:|.|...|:|         |...::|..:. |
  Fly   611 VERIYE----------VSFLPTEPGILTCIAQNIIDGKERRTL---------TKAHVLLGNIS-E 655

  Fly   513 GMETLIGYSYHYKEAPVQNVTM------YDGRHGCGHDNWLM---DVVPNQSRRHVISGLKPYTQ 568
            .| |:.|:...:|.|...||..      |   |..|:..|.:   |:..:.| .|:.:.   :|:
  Fly   656 NM-TIYGFDKDHKIAKEDNVNFTCEALAY---HFDGNLKWFINGEDLKESDS-VHIETS---HTK 712

  Fly   569 YAY----FVKTLTRTE--------YHIQIDAYSKIGYFQTLPDRPSPVLRIYGSSEISSQILLHW 621
            |:|    .:.|::..:        ||...||                   :|.|.||.    |:.
  Fly   713 YSYKSTVHITTISDRDRGTYECRAYHNDKDA-------------------VYSSREID----LYV 754

  Fly   622 WPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVELENAKDIDCECA 668
            ..|..|...           |..:|...|    ::.:.::.::.|||
  Fly   755 HDPSAPQWT-----------NGGQEGHSK----IKRKLSQTLELECA 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 4/12 (33%)
Furin-like 209..332 CDD:279142 26/143 (18%)
Recep_L_domain 347..461 CDD:279382 20/126 (16%)
FN3 491..578 CDD:214495 21/99 (21%)
PvrNP_001162911.1 IG 346..432 CDD:214652 22/108 (20%)
Ig <363..432 CDD:299845 19/101 (19%)
Ig 466..533 CDD:299845 9/79 (11%)
IG_like 672..754 CDD:214653 22/111 (20%)
Ig 674..739 CDD:143165 13/71 (18%)
IGc2 779..840 CDD:197706 3/8 (38%)
PKc_like 927..1332 CDD:304357
Pkinase_Tyr 935..1329 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.