DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdr and Tyro3

DIOPT Version :10

Sequence 1:NP_650408.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_058788.1 Gene:Tyro3 / 25232 RGDID:3923 Length:880 Species:Rattus norvegicus


Alignment Length:289 Identity:55/289 - (19%)
Similarity:91/289 - (31%) Gaps:112/289 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GHLHPV-------PNPLPIPISIAVPLILLF----------------LGASSPVLASSDDQTACG 43
            |.||..       .||..:|:...|..::..                |.|.:.:||  :|.|.| 
  Rat   599 GDLHAFLLASRIGENPFNLPLQTLVRFMVDIACGMEYLSSRNFIHRDLAARNCMLA--EDMTVC- 660

  Fly    44 SLEINKIADLRKLQNCTHVVGHVRLAYVDLTDVSGNY--------------SLDSLASNVTEISD 94
                  :||.          |..|..|      ||:|              :|:|||.|:..:..
  Rat   661 ------VADF----------GLSRKIY------SGDYYRQGCASKLPVKWLALESLADNLYTVHS 703

  Fly    95 YLMVYRCTGLISLQSIFPRLRI----IRGQELLFDQYSLVVYENRNLRELGLVELLRIQSGFIRV 155
            .:..:.    :::..|..|.:.    |...|:    |:.::..|| |::                
  Rat   704 DVWAFG----VTMWEIMTRGQTPYAGIENAEI----YNYLISGNR-LKQ---------------- 743

  Fly   156 ESNPLLCFVETVDWIYLMGNATRQHFSLKHNRPQSQC------PLCGSLSADFEFIRNSSERCWN 214
               |..|..|..|.:|...:|..:      .||...|      .:.|.||     :.::|:....
  Rat   744 ---PPECMEEVYDLMYQCWSADPK------QRPSFTCLRMELENILGHLS-----VLSTSQDPLY 794

  Fly   215 VNTTQLRPQPPRLKDCPIACGLNGCDSAG 243
            :| .:...||.......:.||......||
  Rat   795 IN-IERAGQPAENGSPELPCGEQSSSEAG 822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdrNP_650408.1 Recep_L_domain 58..173 CDD:460032 24/132 (18%)
Furin-like 210..332 CDD:395614 7/34 (21%)
Recep_L_domain 347..461 CDD:460032
FN3 491..578 CDD:214495
Tyro3NP_058788.1 Ig 40..126 CDD:472250
Ig strand B 50..54 CDD:409553
Ig strand C 63..67 CDD:409553
Ig strand E 90..94 CDD:409553
Ig strand F 104..109 CDD:409553
Ig strand G 118..121 CDD:409553
IgI_2_Axl_Tyro3_like 130..209 CDD:409407
Ig strand A 130..133 CDD:409407
Ig strand A' 136..140 CDD:409407
Ig strand B 144..153 CDD:409407
Ig strand C 158..165 CDD:409407
Ig strand C' 167..170 CDD:409407
Ig strand E 174..185 CDD:409407
Ig strand F 188..197 CDD:409407
Ig strand G 201..209 CDD:409407
FN3 215..307 CDD:238020
fn3 315..396 CDD:394996
PTKc_Tyro3 498..781 CDD:270659 44/240 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 804..827 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.