DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdr and Insr

DIOPT Version :9

Sequence 1:NP_001287331.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_058767.2 Gene:Insr / 24954 RGDID:2917 Length:1384 Species:Rattus norvegicus


Alignment Length:946 Identity:262/946 - (27%)
Similarity:410/946 - (43%) Gaps:217/946 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AVPLIL----LFLGASSPVLASSDDQTACGSLEI-NKIADLRKLQNCTHVVGHVRLAYV------ 71
            ||||::    |.:|.:..:....    .|..::| |.:..|.:|:||:.:.||:::..:      
  Rat    11 AVPLLMAVAALLVGTAGHLYPGE----VCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPE 71

  Fly    72 DLTDVSGNYSLDSLASNVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQELLFDQYSLVVYENRN 136
            |..|:|        ...:..|:|||:::|..||.||:.:||.|.:|||..|.|: |:||::|..:
  Rat    72 DFRDLS--------FPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFN-YALVIFEMVH 127

  Fly   137 LRELGLVELLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQHFSLKHNRPQSQ-----CP--- 193
            |:||||..|:.|..|.:|:|.|..||::.|:||..::.:....:..|  |:..::     ||   
  Rat   128 LKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVL--NKDDNEECGDVCPGTA 190

  Fly   194 ----LCGSLSADFEFIRNSSERCWNVNTTQLRPQPPRLKDCPIACGLNGCDSAGKCCDHNCVTGC 254
                .|.:...:.:|:    ||||..:..|        |.||..|..:||.:.|.||...|:..|
  Rat   191 KGKTNCPATVINGQFV----ERCWTHSHCQ--------KVCPTICKSHGCTAEGLCCHKECLGNC 243

  Fly   255 YSQN----CSLCANYQGRMGCVNQCVAS-YELNKRRCIGHRECREL------GRIP-----LIRG 303
            ...:    |..|.|:.....||..|... |.....||:....|::|      .|.|     :|..
  Rat   244 SEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHYKCRNSRKPGCHQYVIHN 308

  Fly   304 YQCVKKCPG----NQKEILVAKGIIHCQVEC---NGDFHVKSAADLEVLQDCVTINGSLTIELTN 361
            .:|:.:||.    |...::....:..|...|   .|:..:.|....:.|:.|..|||||.|   |
  Rat   309 NKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGCTVINGSLII---N 370

  Fly   362 IK--EKIVDALENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRGDKLVENKYALYVVNNYHL 424
            |:  ..:...||..|..::||:|:||:..|..|:||:|.:.|..|||:.|....|:.|.::|.:|
  Rat   371 IRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIGNYSFYALDNQNL 435

  Fly   425 EHIWPPN-HLVIIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSNGERVICGDAVR 488
            ..:|..| |.:.|.:|.||||.||:||..:||:::....:.......|::..:||::..|.:   
  Rat   436 RQLWDWNKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCEN--- 497

  Fly   489 SLNPKVEDLNSTAVRIILD--YMDWE-----GMETLIGYSYHYKEAPVQNVTMYDGRHGCGHDNW 546
                  |.|..:.:|...|  .:.||     ....|:|:...|||||.||||.:||:..||.::|
  Rat   498 ------ELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSW 556

  Fly   547 -LMDVVP--------NQSRRH---VISGLKPYTQYAYFVKTL-TRTEYHIQIDAYSKIGYFQTLP 598
             ::|:.|        :|:..|   ::.||||:||||.||||| |.::......|.|.|.|.||..
  Rat   557 TVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDA 621

  Fly   599 DRPSPVLRIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYV---------- 653
            ..||..|.....|..||||:|.|.||..|||.|.:|.|..|:.....|..:.:|.          
  Rat   622 TNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQAEDSELFELDYCLKGLKLPSRT 686

  Fly   654 --------NVELENAKDID------CECAGVLPYYSGPQPD-------DEDYYNKEQITYEDALP 697
                    :.:..|..:.|      |.|         |:.|       :|..:.|   |:||.|.
  Rat   687 WSPPFESDDSQKHNQSEYDDSASECCSC---------PKTDSQILKELEESSFRK---TFEDYLH 739

  Fly   698 NLIYVSRNHDYRRKEFEKVINYEHLLSIKKDEEPTRPPTTTPAPTNATLAKERLAAINYENYRLN 762
            |:::|.|.                 .|.....|.|||                            
  Rat   740 NVVFVPRK-----------------TSSGNGAEDTRP---------------------------- 759

  Fly   763 SEKKQRDLQDLDQHKYTIRHALPKCQNSHASVV------QQVEEKCVAEEPLSGYELPGTQHFYC 821
             .:|:|.|:::.....| ...||...|..:::.      .:..||.|.:|.|   .:.|.:||  
  Rat   760 -SRKRRSLEEVGNVTAT-TPTLPDFPNISSTIAPTSHEEHRPFEKVVNKESL---VISGLRHF-- 817

  Fly   822 LSQLEPETHYRITIRAC-VEGVVNGCSTPAEAVIKT 856
                   |.|||.::|| .:.....||..|....:|
  Rat   818 -------TGYRIELQACNQDSPEERCSVAAYVSART 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdrNP_001287331.1 Recep_L_domain 58..173 CDD:279382 44/120 (37%)
Furin-like 209..332 CDD:279142 36/145 (25%)
Recep_L_domain 347..461 CDD:279382 46/116 (40%)
FN3 491..578 CDD:214495 39/106 (37%)
InsrNP_058767.2 Recep_L_domain 52..164 CDD:279382 44/120 (37%)
Furin-like 179..337 CDD:279142 39/169 (23%)
FU 234..281 CDD:238021 12/46 (26%)
Recep_L_domain 359..472 CDD:279382 46/115 (40%)
FN3 624..>667 CDD:238020 19/42 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..710 2/21 (10%)
Insulin-binding. /evidence=ECO:0000250 735..743 4/7 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 748..784 11/65 (17%)
FN3 869..946 CDD:238020
Important for interaction with IRS1, SHC1 and STAT5B 998..1001
PTKc_InsR 1018..1305 CDD:133192
Pkinase_Tyr 1025..1292 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1362..1384
PIK3R1 binding. /evidence=ECO:0000250 1363..1366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8051
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D120934at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.