DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdr and Epha10

DIOPT Version :10

Sequence 1:NP_650408.1 Gene:Sdr / 41809 FlyBaseID:FBgn0038279 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001243361.1 Gene:Epha10 / 230735 MGIID:3586824 Length:1007 Species:Mus musculus


Alignment Length:139 Identity:30/139 - (21%)
Similarity:41/139 - (29%) Gaps:41/139 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DWIYLMGNATRQHFSLKHNRPQSQC-----------PLCGSLSADFEFIRNSSERCWNVNTTQLR 221
            :|:..:|..:......:|......|           |||.........:.|:|..|...:|....
Mouse   261 EWLVPVGRCSCSAGFQEHGDICEACPPGFYKVSPRRPLCSPCPEHSLALENASTFCVCQDTYARS 325

  Fly   222 PQPPRLKDC-----------------PIACGLN---GCDSAGKCCDHNCVTGCYSQNCSLCANYQ 266
            |..|....|                 |:|..|.   ..||.|:    :.||  ||..|..|    
Mouse   326 PTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGR----SDVT--YSLLCLRC---- 380

  Fly   267 GRMGCVNQC 275
            ||.|....|
Mouse   381 GRDGPAGAC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SdrNP_650408.1 Recep_L_domain 58..173 CDD:460032 1/4 (25%)
Furin-like 210..332 CDD:395614 21/86 (24%)
Recep_L_domain 347..461 CDD:460032
FN3 491..578 CDD:214495
Epha10NP_001243361.1 EphR_LBD 35..210 CDD:470656
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..343 3/19 (16%)
fn3 339..431 CDD:394996 16/61 (26%)
FN3 451..551 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..486
EphA2_TM 569..641 CDD:464211
Protein Kinases, catalytic domain 638..902 CDD:473864
SAM_EPH-A10 928..997 CDD:188948
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.