DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and RPS5A

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_187800.1 Gene:RPS5A / 820367 AraportID:AT3G11940 Length:207 Species:Arabidopsis thaliana


Alignment Length:190 Identity:147/190 - (77%)
Similarity:170/190 - (89%) Gaps:1/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EIKLFGRWACDDISISDISLQDYIAVK-EKFARYLPHSAGRYAAKRFRKAQCPIVERLTSGLMMK 105
            |:|||.||..||::::||||.|||.|: .|.|.::||:||||:.|||||||||||||||:.|||.
plant    18 EVKLFNRWTYDDVTVTDISLVDYIGVQAAKHATFVPHTAGRYSVKRFRKAQCPIVERLTNSLMMH 82

  Fly   106 GRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPREDSTRIGRAGTVRRQAVDVSPL 170
            ||:|||||:|.||||||.||||||:..||:||.::||||||||||:||||.||.|||||||:|||
plant    83 GRNNGKKLMAVRIVKHAMEIIHLLSDLNPIQVIIDAIVNSGPREDATRIGSAGVVRRQAVDISPL 147

  Fly   171 RRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 230
            |||||||:||.|||||||||||||:||||||||||||||||||||||||||:|||||:||
plant   148 RRVNQAIFLITTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDEIERVAKANR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 144/186 (77%)
RPS5ANP_187800.1 uS7_Eukaryote 20..207 CDD:271246 144/186 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 241 1.000 Domainoid score I583
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I783
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - mtm1196
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - O PTHR11205
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.