DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and zgc:153322

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001038898.2 Gene:zgc:153322 / 751723 ZFINID:ZDB-GENE-060825-73 Length:212 Species:Danio rerio


Alignment Length:211 Identity:170/211 - (80%)
Similarity:190/211 - (90%) Gaps:0/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EQEDWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHSAGRYAA 84
            :.|:|..|.|....|....|.||:||||||:|:|:.:||:||||||||||.:|:::|||||||||
Zfish     2 DDENWETDAVMVATAPAPAELPEVKLFGRWSCEDVQVSDMSLQDYIAVKENYAKFIPHSAGRYAA 66

  Fly    85 KRFRKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPRE 149
            |||||||||||||:|:.|||.||:|||||:|.||:|||.|||||||.||||||.||||:||||||
Zfish    67 KRFRKAQCPIVERVTNSLMMHGRNNGKKLMAVRIMKHAMEIIHLLTGENPLQVLVNAIINSGPRE 131

  Fly   150 DSTRIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSY 214
            ||||||||||||||||||||||||||||||:||||||||||||||:|||||||||||||||||||
Zfish   132 DSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSY 196

  Fly   215 AIKKKDELERVAKSNR 230
            ||||||||||||||||
Zfish   197 AIKKKDELERVAKSNR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 160/185 (86%)
zgc:153322NP_001038898.2 uS7_Eukaryote 26..212 CDD:271246 160/185 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.