DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and RPS5

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001000.2 Gene:RPS5 / 6193 HGNCID:10426 Length:204 Species:Homo sapiens


Alignment Length:208 Identity:174/208 - (83%)
Similarity:189/208 - (90%) Gaps:6/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHSAGRYAAKRF 87
            :|.    |..||  |.|.|:|||||:|:.||:.|:|||||||||||||:|:||||||||||||||
Human     3 EWE----TAAPA--VAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRF 61

  Fly    88 RKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPREDST 152
            ||||||||||||:.:||.||:|||||:..||||||||||||||.||||||.||||:|||||||||
Human    62 RKAQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDST 126

  Fly   153 RIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAIK 217
            |||||||||||||||||||||||||||:||||||||||||||:||||||||||||||||||||||
Human   127 RIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIK 191

  Fly   218 KKDELERVAKSNR 230
            |||||||||||||
Human   192 KKDELERVAKSNR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 164/185 (89%)
RPS5NP_001000.2 uS7_Eukaryote 18..204 CDD:271246 164/185 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150888
Domainoid 1 1.000 93 1.000 Domainoid score I7557
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 355 1.000 Inparanoid score I2241
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm41307
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.