DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and rps5

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001016992.1 Gene:rps5 / 549746 XenbaseID:XB-GENE-919703 Length:203 Species:Xenopus tropicalis


Alignment Length:208 Identity:171/208 - (82%)
Similarity:186/208 - (89%) Gaps:7/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHSAGRYAAKRF 87
            ||     .|:|..  .|.|||||||:|:.||:.|:|||||||||||||:|::||||.||||||||
 Frog     3 DW-----ETVPVG--AETPEIKLFGKWSTDDVQINDISLQDYIAVKEKYAKFLPHSGGRYAAKRF 60

  Fly    88 RKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPREDST 152
            ||||||||||.|:.|||.||:|||||:..||||||||||||||.||||||.||||:|||||||||
 Frog    61 RKAQCPIVERFTNSLMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDST 125

  Fly   153 RIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAIK 217
            |||||||||||||||||||||||||||:||||||||||||||:|||:||||||||||||||||||
 Frog   126 RIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELINAAKGSSNSYAIK 190

  Fly   218 KKDELERVAKSNR 230
            |||||||||||||
 Frog   191 KKDELERVAKSNR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 161/185 (87%)
rps5NP_001016992.1 uS7_Eukaryote 17..203 CDD:271246 161/185 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7736
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I2233
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm48513
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.