DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and MRPS7

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_057055.2 Gene:MRPS7 / 51081 HGNCID:14499 Length:242 Species:Homo sapiens


Alignment Length:236 Identity:52/236 - (22%)
Similarity:93/236 - (39%) Gaps:55/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SQVIPQEQEDWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHS 78
            |:..|:.::...|......|.:|:||                            :||:.|.|..:
Human    35 SRYSPEFKDPLIDKEYYRKPVEELTE----------------------------EEKYVRELKKT 71

  Fly    79 ---AGRYAAKRFRKAQCPIVERLTSGLMMKGRSNGKKLLACRIV--------KHAFEIIHLLTSE 132
               ....|.|.....:.|::.:.|: :||.|   |.|:||..::        :..||..|..::|
Human    72 QLIKAAPAGKTSSVFEDPVISKFTN-MMMIG---GNKVLARSLMIQTLEAVKRKQFEKYHAASAE 132

  Fly   133 -------NPLQVTVNAIVNSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAI-WLICTGAREAAF 189
                   ||..:...|:.|..|......|.:.|...:..|.:...||...|: |:| |..|:...
Human   133 EQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRRFLAMKWMI-TECRDKKH 196

  Fly   190 RNIKTVAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 230
            :. ..:.|.|:.:|:.|.  .:....||:|.:|.::|::||
Human   197 QR-TLMPEKLSHKLLEAF--HNQGPVIKRKHDLHKMAEANR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 43/204 (21%)
MRPS7NP_057055.2 uS7_Mitochondria_Mammalian 35..240 CDD:271249 52/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.