DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and mRpS7

DIOPT Version :10

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_523537.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster


Alignment Length:138 Identity:40/138 - (28%)
Similarity:60/138 - (43%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GKKLLACRIVKHAFEIIHLLTSE--------------NPLQVTVNAIVNSGPREDSTRIGRAGTV 160
            |...||..::....|:|....:|              ||..:...|:.|..|....|.|.|.|..
  Fly    80 GNSALARTLLSKTLELIKRTQTEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVT 144

  Fly   161 RRQAVDVSPLRRVNQAI-WLICTGAREAAFRNIKTVA--ECLADELINAAKGSSNSYAIKKKDEL 222
            .:..|.::..|....|: ||:     |||....:.|:  |.||.|:::||.|...  .||:||:|
  Fly   145 YQVPVPITTKRSYFLAMKWLL-----EAAREKERKVSLPEKLAWEILDAAHGQGR--VIKRKDDL 202

  Fly   223 ERVAKSNR 230
            .|:.:|||
  Fly   203 HRLCESNR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 38/136 (28%)
mRpS7NP_523537.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 40/138 (29%)

Return to query results.
Submit another query.