DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and mRpS7

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster


Alignment Length:138 Identity:40/138 - (28%)
Similarity:60/138 - (43%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GKKLLACRIVKHAFEIIHLLTSE--------------NPLQVTVNAIVNSGPREDSTRIGRAGTV 160
            |...||..::....|:|....:|              ||..:...|:.|..|....|.|.|.|..
  Fly    80 GNSALARTLLSKTLELIKRTQTEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVT 144

  Fly   161 RRQAVDVSPLRRVNQAI-WLICTGAREAAFRNIKTVA--ECLADELINAAKGSSNSYAIKKKDEL 222
            .:..|.::..|....|: ||:     |||....:.|:  |.||.|:::||.|...  .||:||:|
  Fly   145 YQVPVPITTKRSYFLAMKWLL-----EAAREKERKVSLPEKLAWEILDAAHGQGR--VIKRKDDL 202

  Fly   223 ERVAKSNR 230
            .|:.:|||
  Fly   203 HRLCESNR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 38/136 (28%)
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 40/138 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0049
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.