DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and Rps5

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001264172.1 Gene:Rps5 / 25538 RGDID:3601 Length:204 Species:Rattus norvegicus


Alignment Length:208 Identity:174/208 - (83%)
Similarity:189/208 - (90%) Gaps:6/208 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHSAGRYAAKRF 87
            :|.    |..||  |.|.|:|||||:|:.||:.|:|||||||||||||:|:||||||||||||||
  Rat     3 EWE----TATPA--VAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRF 61

  Fly    88 RKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPREDST 152
            ||||||||||||:.:||.||:|||||:..||||||||||||||.||||||.||||:|||||||||
  Rat    62 RKAQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDST 126

  Fly   153 RIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAIK 217
            |||||||||||||||||||||||||||:||||||||||||||:||||||||||||||||||||||
  Rat   127 RIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIK 191

  Fly   218 KKDELERVAKSNR 230
            |||||||||||||
  Rat   192 KKDELERVAKSNR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 164/185 (89%)
Rps5NP_001264172.1 uS7_Eukaryote 18..204 CDD:271246 164/185 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344418
Domainoid 1 1.000 263 1.000 Domainoid score I1861
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I2215
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm45434
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.