DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and rps5

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_594279.1 Gene:rps5 / 2542939 PomBaseID:SPAC8C9.08 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:138/198 - (69%)
Similarity:161/198 - (81%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHSAGRYAAKRFRKAQCPIVER 97
            |...:.|...||||.::..:.:.:.||||.|||.:..  .:.|||:|||:..||||||:|.||||
pombe     8 PGVSLDENGSIKLFNKFPFEGVEVKDISLVDYITIGN--GQPLPHTAGRFQTKRFRKARCFIVER 70

  Fly    98 LTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPREDSTRIGRAGTVRR 162
            ||:.|||.||:|||||||.||||||||||.|||.:|||||.|:|:...||||||||||.||||||
pombe    71 LTNSLMMNGRNNGKKLLATRIVKHAFEIIALLTDQNPLQVLVDAVAACGPREDSTRIGSAGTVRR 135

  Fly   163 QAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAIKKKDELERVAK 227
            ||||||||||||||:.||..|||||||||:|:::||||:|:||||||||||||||||||||||||
pombe   136 QAVDVSPLRRVNQALALITIGAREAAFRNVKSISECLAEEIINAAKGSSNSYAIKKKDELERVAK 200

  Fly   228 SNR 230
            |||
pombe   201 SNR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 133/185 (72%)
rps5NP_594279.1 uS7_Eukaryote 19..203 CDD:271246 133/185 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 226 1.000 Domainoid score I522
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 268 1.000 Inparanoid score I717
OMA 1 1.010 - - QHG62189
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - mtm9304
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.