DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and rps502

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_594212.1 Gene:rps502 / 2541712 PomBaseID:SPAC328.10c Length:203 Species:Schizosaccharomyces pombe


Alignment Length:218 Identity:141/218 - (64%)
Similarity:167/218 - (76%) Gaps:16/218 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASQVIPQEQEDWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPH 77
            |:.:||:|              ..:.|...||||.::..:.:.:.||||.|||.:..  .:.|||
pombe     2 AASIIPKE--------------VSLDETGHIKLFNKFPFEGVEVKDISLVDYITIGN--GQPLPH 50

  Fly    78 SAGRYAAKRFRKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAI 142
            :|||:..||||||:|.||||||:.|||.||:|||||||.||||||||||.|||.:|||||.|:|:
pombe    51 TAGRFQTKRFRKARCFIVERLTNSLMMNGRNNGKKLLATRIVKHAFEIIALLTDQNPLQVLVDAV 115

  Fly   143 VNSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAA 207
            ...||||||||||.||||||||||||||||||||:.||..|||||||||:|:::||||:|:||||
pombe   116 AACGPREDSTRIGSAGTVRRQAVDVSPLRRVNQALALITIGAREAAFRNVKSISECLAEEIINAA 180

  Fly   208 KGSSNSYAIKKKDELERVAKSNR 230
            |||||||||||||||||||||||
pombe   181 KGSSNSYAIKKKDELERVAKSNR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 133/185 (72%)
rps502NP_594212.1 uS7_Eukaryote 19..203 CDD:271246 133/185 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 226 1.000 Domainoid score I522
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 268 1.000 Inparanoid score I717
OMA 1 1.010 - - QHG62189
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - mtm9304
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.