DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and Rps5

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_033121.2 Gene:Rps5 / 20103 MGIID:1097682 Length:204 Species:Mus musculus


Alignment Length:198 Identity:172/198 - (86%)
Similarity:186/198 - (93%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHSAGRYAAKRFRKAQCPIVER 97
            ||  |.|.|:|||||:|:.||:.|:|||||||||||||:|:||||||||||||||||||||||||
Mouse     9 PA--VAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIVER 71

  Fly    98 LTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPREDSTRIGRAGTVRR 162
            ||:.:||.||:|||||:..||||||||||||||.||||||.||||:|||||||||||||||||||
Mouse    72 LTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRR 136

  Fly   163 QAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAIKKKDELERVAK 227
            |||||||||||||||||:||||||||||||||:||||||||||||||||||||||||||||||||
Mouse   137 QAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAK 201

  Fly   228 SNR 230
            |||
Mouse   202 SNR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 164/185 (89%)
Rps5NP_033121.2 uS7_Eukaryote 18..204 CDD:271246 164/185 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840997
Domainoid 1 1.000 91 1.000 Domainoid score I7683
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 351 1.000 Inparanoid score I2257
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62189
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm43365
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.