DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and rps5

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_775339.1 Gene:rps5 / 192297 ZFINID:ZDB-GENE-020419-12 Length:204 Species:Danio rerio


Alignment Length:209 Identity:172/209 - (82%)
Similarity:187/209 - (89%) Gaps:7/209 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EDWADDVVTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFARYLPHSAGRYAAKR 86
            |||.       .|..|.|.|||||||:|:.||:.|:|||||||||||||:|:|||||:|||||||
Zfish     3 EDWE-------AAPAVAETPEIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSSGRYAAKR 60

  Fly    87 FRKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSENPLQVTVNAIVNSGPREDS 151
            |||||||||||:|:.:||.||:||||||..||||||||||||||.|||||:.||||:||||||||
Zfish    61 FRKAQCPIVERVTNSMMMHGRNNGKKLLTVRIVKHAFEIIHLLTGENPLQILVNAIINSGPREDS 125

  Fly   152 TRIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAI 216
            ||||||||||||||||||||||||||||:||||||||||||||:|||||||||||||||.|||||
Zfish   126 TRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSYNSYAI 190

  Fly   217 KKKDELERVAKSNR 230
            ||||||||||||||
Zfish   191 KKKDELERVAKSNR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 161/185 (87%)
rps5NP_775339.1 uS7_Eukaryote 18..204 CDD:271246 161/185 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585496
Domainoid 1 1.000 92 1.000 Domainoid score I7601
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 351 1.000 Inparanoid score I2242
OMA 1 1.010 - - QHG62189
OrthoDB 1 1.010 - - D1532160at2759
OrthoFinder 1 1.000 - - FOG0003144
OrthoInspector 1 1.000 - - otm26493
orthoMCL 1 0.900 - - OOG6_100920
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2112
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.