DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and mrps-7

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_502782.2 Gene:mrps-7 / 190379 WormBaseID:WBGene00013324 Length:222 Species:Caenorhabditis elegans


Alignment Length:152 Identity:34/152 - (22%)
Similarity:54/152 - (35%) Gaps:47/152 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NGKKLLACRIVKHAFEIIH-------LLTSE--------NPLQVTVNAIVNSGPREDSTRIGRAG 158
            :|:|..:.:.|..|.|||.       ...||        :|..|....|.|..|......:.|.|
 Worm    81 DGEKETSRKNVLSALEIIKRRQYKAWAKASEEEKKSIELDPFLVAKKGIKNCHPLMKLQGVTRGG 145

  Fly   159 TVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIKTVAE-C--------------LADELINAAK 208
            |..:....:.               ..||.||.:|.:.: |              ||.||:.|::
 Worm   146 TTYQVPFPIE---------------EPEAEFRAMKMMRDICRVRSKHGETHFKDILATELLAASQ 195

  Fly   209 GSSNSYAIKKKDELERVAKSNR 230
            ...::  |:.|.||.:..::||
 Worm   196 NEGST--IQAKQELHKTCEANR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 32/150 (21%)
mrps-7NP_502782.2 uS7_Mitochondria_Mammalian 23..221 CDD:271249 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.