DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS5b and Mrps7

DIOPT Version :9

Sequence 1:NP_650407.1 Gene:RpS5b / 41807 FlyBaseID:FBgn0038277 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001093941.1 Gene:Mrps7 / 113958 RGDID:1309164 Length:242 Species:Rattus norvegicus


Alignment Length:191 Identity:43/191 - (22%)
Similarity:84/191 - (43%) Gaps:27/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ISDISLQDYIAVKEKFARYLPHSAGRYAAKRFRKAQCPIVERLTSGLMMKGRSNGKKLLACRIVK 120
            :|:::.::...::.|..:.:..:|....:..|..   |::.:.|: :||||   |.|:||..::.
  Rat    55 VSELTEEEKYDLELKKTQLIKAAAATETSSVFAD---PVISKFTN-MMMKG---GNKVLARSLMA 112

  Fly   121 HAFEII---------------HLLTSENPLQVTVNAIVNSGPREDSTRIGRAGTVRRQAVDVSPL 170
            ...|.:               ......||.::...|:.|..|......|.:.|...:..|.::..
  Rat   113 QTLEAVKRKQFEKYRAASAEEQATIERNPYKIFHEALRNCEPVIGLVPILKGGHFYQVPVPLADR 177

  Fly   171 RRVNQAI-WLICTGAREAAFRNIKTVAECLADELINAAKGSSNSYAIKKKDELERVAKSNR 230
            ||...|: |:| |..||...|.: .:.|.|:.||:.|.  .:....||:|..:.::|::||
  Rat   178 RRRFLAMKWMI-TECRENKPRRM-LMPEKLSHELLEAF--HNRGPVIKRKHNMHKMAEANR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS5bNP_650407.1 uS7_Eukaryote 44..230 CDD:271246 41/189 (22%)
Mrps7NP_001093941.1 uS7_Mitochondria_Mammalian 35..240 CDD:271249 43/191 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.