DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and AT4G32530

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001119099.1 Gene:AT4G32530 / 829388 AraportID:AT4G32530 Length:210 Species:Arabidopsis thaliana


Alignment Length:207 Identity:86/207 - (41%)
Similarity:121/207 - (58%) Gaps:35/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MVNMGERMGLGWFLYTSNPFLWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLI 96
            :|.:|.....|..|...:|:.:|.:||.::..:||||||.|||:.|.|:.|..:.:|||.:||||
plant     4 VVALGHASSWGAALVRISPYTFSAIGIAISIGVSVLGAAWGIYITGSSLIGAAIEAPRITSKNLI 68

  Fly    97 SVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACG-- 159
            ||||||||||||:|.||:|...:....|.::..     |.::..|:|.|.:|:.||..|:.||  
plant    69 SVIFCEAVAIYGVIVAIILQTKLESVPSSKMYD-----AESLRAGYAIFASGIIVGFANLVCGSV 128

  Fly   160 ----------------------------IAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLF 196
                                        :.|||:||..||:||.||.||||||::||||||:|||
plant   129 STLFSFLTVLVFGFHCQICNRGPHFSCRLCVGIIGSSCALSDAQNSTLFVKILVIEIFGSALGLF 193

  Fly   197 GLIVAIYMTSKA 208
            |:||.|.|:::|
plant   194 GVIVGIIMSAQA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 51/139 (37%)
ATP-synt_C 143..204 CDD:278563 38/90 (42%)
AT4G32530NP_001119099.1 ATP-synt_C 26..87 CDD:278563 37/60 (62%)
ATP-synt_C <157..202 CDD:278563 30/44 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2742
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I1468
OMA 1 1.010 - - QHG53850
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 1 1.000 - - mtm1161
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.