DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and atp6v0b

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001017064.1 Gene:atp6v0b / 549818 XenbaseID:XB-GENE-997920 Length:205 Species:Xenopus tropicalis


Alignment Length:191 Identity:108/191 - (56%)
Similarity:140/191 - (73%) Gaps:5/191 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ASLGAVGIIFANVMVNMGERMGLGWFLYTSNPFLWSGMGIFLACALSVLGAASGIYMIGCSVAGG 83
            |:|..||..:  .:.::|.|..:.|||..::|::|:.:||.|:.:|||:|||.|||:.|.|:.||
 Frog    17 ATLIIVGTCY--TIFDLGFRFDVAWFLTETSPYMWANLGIGLSISLSVVGAAWGIYITGSSILGG 79

  Fly    84 GVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAG 148
            ||::||||||||:|:||||||||||:|.||::|....:|...   |...:.:.|...||:.||||
 Frog    80 GVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEQFKGT---TPEAIGSRNYHAGFSMFGAG 141

  Fly   149 LCVGMVNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVAIYMTSKAE 209
            |.||..|:.|||.|||||||||||||.|.:|||||||||||||||||||:||||..|||.:
 Frog   142 LTVGFSNLFCGICVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSKVK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 60/109 (55%)
ATP-synt_C 143..204 CDD:278563 48/60 (80%)
atp6v0bNP_001017064.1 ATP-synt_C 52..111 CDD:306615 40/58 (69%)
ATP-synt_C 138..196 CDD:306615 47/57 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 95 1.000 Domainoid score I7291
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3397
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 1 1.000 - - otm48294
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.