DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and ATP6V0B

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001281262.1 Gene:ATP6V0B / 533 HGNCID:861 Length:261 Species:Homo sapiens


Alignment Length:195 Identity:111/195 - (56%)
Similarity:143/195 - (73%) Gaps:7/195 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFFMLFVLGAASLGAVGIIFANVMVNMGERMGLGWFLYTSNPFLWSGMGIFLACALSVLGAASGI 73
            |:..:||...|...|||:.:  .:.::|.|..:.|||..::||:||.:||.||.:|||:|||.||
Human     7 LYSGVFVAFWACALAVGVCY--TIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGI 69

  Fly    74 YMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMA-TN 137
            |:.|.|:.||||::||||||||:|:||||||||||:|.||::|.....||:    ||...:. .|
Human    70 YITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSA----TDPKAIGHRN 130

  Fly   138 MFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVAI 202
            ...|::.|||||.||:.|:.||:.|||||||||||||.|.:|||||||||||||||||||:||||
Human   131 YHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAI 195

  Fly   203  202
            Human   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 61/110 (55%)
ATP-synt_C 143..204 CDD:278563 47/60 (78%)
ATP6V0BNP_001281262.1 PRK08344 48..199 CDD:236246 97/152 (64%)
ATP-synt_C 52..112 CDD:278563 41/59 (69%)
ATP-synt_C 136..196 CDD:278563 47/60 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143521
Domainoid 1 1.000 96 1.000 Domainoid score I7345
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S432
OMA 1 1.010 - - QHG53850
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.670

Return to query results.
Submit another query.