DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and VhaPPA1-1

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001247111.1 Gene:VhaPPA1-1 / 45247 FlyBaseID:FBgn0028662 Length:212 Species:Drosophila melanogaster


Alignment Length:200 Identity:127/200 - (63%)
Similarity:158/200 - (79%) Gaps:5/200 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FFMLFVLGAASLGAVGIIFANVMVNMGERMGLGWFLYTSNPFLWSGMGIFLACALSVLGAASGIY 74
            |..||:..|..|   .:.|  ||...|||:.:||||.:|||::|:.:||.|:.:|||:|||.||:
  Fly    13 FLWLFLAVATIL---TLYF--VMTGKGERVSVGWFLASSNPYMWACLGIGLSVSLSVVGAALGIH 72

  Fly    75 MIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMATNMF 139
            ..|.|:.||||::||||||||||||||||||||||||||:|||.:.:||....::.:.:..||.|
  Fly    73 TTGTSIVGGGVKAPRIKTKNLISVIFCEAVAIYGLITAIVLSGQLEQFSMETALSQAAIQNTNWF 137

  Fly   140 TGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVAIYM 204
            :|:..|||||.||:||:.||||||||||||||:||||:|||||||||||||||||||||||.|||
  Fly   138 SGYLIFGAGLAVGLVNLFCGIAVGIVGSGAALSDAANAALFVKILIVEIFGSAIGLFGLIVGIYM 202

  Fly   205 TSKAE 209
            |||::
  Fly   203 TSKSK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 68/109 (62%)
ATP-synt_C 143..204 CDD:278563 51/60 (85%)
VhaPPA1-1NP_001247111.1 ATP-synt_Vo_c_ATP6F_rpt1 51..113 CDD:349417 44/61 (72%)
ATP-synt_Vo_c_ATP6F_rpt2 138..202 CDD:349418 52/63 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443410
Domainoid 1 1.000 87 1.000 Domainoid score I2742
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I1468
Isobase 1 0.950 - 0 Normalized mean entropy S432
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 1 1.000 - - mtm1161
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2155
1211.750

Return to query results.
Submit another query.