DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and Vha16-1

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster


Alignment Length:164 Identity:58/164 - (35%)
Similarity:85/164 - (51%) Gaps:14/164 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TSNPF---LWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYG 108
            :.||.   .:..||...|...|.||||.|....|..:|...|..|.:..|::|.|:....:||||
  Fly     7 SDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYG 71

  Fly   109 LITAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALAD 173
            |:.|:|::|.:.:.|..           :::.||...||||.||...:|.|.|:||||.......
  Fly    72 LVVAVLIAGALEEPSKY-----------SLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGT 125

  Fly   174 AANSALFVKILIVEIFGSAIGLFGLIVAIYMTSK 207
            |....|||.::::.||...:||:|||||||:.:|
  Fly   126 AQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 38/109 (35%)
ATP-synt_C 143..204 CDD:278563 27/60 (45%)
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 40/117 (34%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 30/66 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453383
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.