DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and atp5mc3a

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_957470.1 Gene:atp5mc3a / 394151 ZFINID:ZDB-GENE-040426-857 Length:139 Species:Danio rerio


Alignment Length:104 Identity:29/104 - (27%)
Similarity:43/104 - (41%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 TAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALAD-- 173
            ||.:|...|.:. ::|....|.| :.::.|.....|||          ...||:.||||.:..  
Zfish    41 TAAILQSPVAQM-ALRSFQTSAV-SRDIDTAAKFIGAG----------AATVGVAGSGAGIGTVF 93

  Fly   174 -------AANSALFVKILIVEIFG----SAIGLFGLIVA 201
                   |.|.:|..::....|.|    .|:|||.|:||
Zfish    94 GSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 13/54 (24%)
ATP-synt_C 143..204 CDD:278563 21/72 (29%)
atp5mc3aNP_957470.1 ATP9 65..139 CDD:164765 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.