DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and Vha16-4

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_611169.1 Gene:Vha16-4 / 36900 FlyBaseID:FBgn0262513 Length:155 Species:Drosophila melanogaster


Alignment Length:152 Identity:53/152 - (34%)
Similarity:81/152 - (53%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVN 120
            :|...|...|.||||.|.......::...::.|::..|.::.|:....:|||||:.|:||:|:::
  Fly    17 LGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQLIMKAIVPVVMAGIIAIYGLVIAVLLAGSLS 81

  Fly   121 KFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILI 185
            ...|.             :.||....|||.||:..:..|||:|:||.....|.|....|||.|::
  Fly    82 SPYSA-------------YKGFLNLSAGLAVGVSGMGAGIAIGVVGEAGVRASAQQPKLFVAIIL 133

  Fly   186 VEIFGSAIGLFGLIVAIYMTSK 207
            :.||...:||:|||||||:.||
  Fly   134 ILIFAEVLGLYGLIVAIYLFSK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 32/109 (29%)
ATP-synt_C 143..204 CDD:278563 27/60 (45%)
Vha16-4NP_611169.1 ATP-synt_C 13..118 CDD:294318 34/113 (30%)
ATP-synt_C 93..152 CDD:278563 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453379
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.