DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and atp6v0b

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_955855.2 Gene:atp6v0b / 321724 ZFINID:ZDB-GENE-030131-443 Length:206 Species:Danio rerio


Alignment Length:189 Identity:110/189 - (58%)
Similarity:140/189 - (74%) Gaps:5/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VGIIFANVMVNMGERMGLGWFLYTSNPFLWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSP 88
            |||.:  .:.::|.|..:.|||..::||:|:.:||.||.:|||:|||.|||:.|.|:.||||::|
Zfish    23 VGICY--TIFDLGFRFDVAWFLTETSPFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAP 85

  Fly    89 RIKTKNLISVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGM 153
            |||||||:|:||||||||||:|.||::|.....||..   |..|:.:.|...|::.|||||.||.
Zfish    86 RIKTKNLVSIIFCEAVAIYGIIMAIVISNLAENFSGT---TPETIGSKNYQAGYSMFGAGLTVGF 147

  Fly   154 VNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVAIYMTSKAETIN 212
            .|:.|||.|||||||||||||.|:.|||:|||||||||||||||:||||..|||.:..|
Zfish   148 SNLFCGICVGIVGSGAALADAQNANLFVRILIVEIFGSAIGLFGVIVAILQTSKVKMGN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 62/109 (57%)
ATP-synt_C 143..204 CDD:278563 47/60 (78%)
atp6v0bNP_955855.2 PRK08344 49..200 CDD:236246 96/153 (63%)
ATP-synt_C 51..113 CDD:278563 41/61 (67%)
ATP-synt_C 137..197 CDD:278563 46/59 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576389
Domainoid 1 1.000 94 1.000 Domainoid score I7439
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I3371
OMA 1 1.010 - - QHG53850
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.