powered by:
Protein Alignment VhaPPA1-2 and Atp6v0b
DIOPT Version :9
Sequence 1: | NP_650406.2 |
Gene: | VhaPPA1-2 / 41806 |
FlyBaseID: | FBgn0262514 |
Length: | 212 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001100151.1 |
Gene: | Atp6v0b / 298451 |
RGDID: | 1308303 |
Length: | 100 |
Species: | Rattus norvegicus |
Alignment Length: | 73 |
Identity: | 51/73 - (69%) |
Similarity: | 60/73 - (82%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 NMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVA 201
|...|::.|||||.||:.|:.||:.|||||||||||||.|.:|||||||||||||||||||:|||
Rat 25 NYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVA 89
Fly 202 IYMTSKAE 209
|..||:.:
Rat 90 ILQTSRVK 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1408246at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.