DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and Atp6v0b

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001100151.1 Gene:Atp6v0b / 298451 RGDID:1308303 Length:100 Species:Rattus norvegicus


Alignment Length:73 Identity:51/73 - (69%)
Similarity:60/73 - (82%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 NMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVA 201
            |...|::.|||||.||:.|:.||:.|||||||||||||.|.:|||||||||||||||||||:|||
  Rat    25 NYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVA 89

  Fly   202 IYMTSKAE 209
            |..||:.:
  Rat    90 ILQTSRVK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 15/28 (54%)
ATP-synt_C 143..204 CDD:278563 47/60 (78%)
Atp6v0bNP_001100151.1 ATP-synt_C 31..91 CDD:278563 46/59 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1408246at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.