DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and vma16

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_594516.1 Gene:vma16 / 2541999 PomBaseID:SPAC2C4.13 Length:199 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:94/198 - (47%)
Similarity:126/198 - (63%) Gaps:7/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LFVLGAASLGAVGIIFANVMV--NMGERMGLGWFLYTSNPFLWSGMGIFLACALSVLGAASGIYM 75
            ||.....:...:.||....|:  |.||....|.||..::|:.|..:||....|..::|||.||::
pombe     3 LFSTSLWTTTVMSIIVGLYMLFHNSGESFDFGSFLLDTSPYTWGLLGIASCVAFGIIGAAWGIFI 67

  Fly    76 IGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAILLSGNVNKFSSVRLITDSTVMATNMFT 140
            .|.|:.||.|::||||||||||:||||.||||.||.||:.|..:|..:.....|.|     :.:|
pombe    68 CGTSILGGAVKAPRIKTKNLISIIFCEVVAIYSLIIAIVFSAKINDINPAGFYTKS-----HYYT 127

  Fly   141 GFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSALFVKILIVEIFGSAIGLFGLIVAIYMT 205
            |||.|..|:.||:.|:.||:.|||.||.||||||.:::||||:|:||||||.:|||||||.:.:.
pombe   128 GFALFWGGITVGLCNLICGVCVGITGSSAALADAQDASLFVKVLVVEIFGSVLGLFGLIVGLLIG 192

  Fly   206 SKA 208
            .||
pombe   193 GKA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 53/109 (49%)
ATP-synt_C 143..204 CDD:278563 37/60 (62%)
vma16NP_594516.1 ATP-synt_C 45..155 CDD:294318 55/114 (48%)
ATP-synt_C 130..191 CDD:278563 37/60 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 83 1.000 Domainoid score I2250
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 193 1.000 Inparanoid score I1033
OMA 1 1.010 - - QHG53850
OrthoFinder 1 1.000 - - FOG0002690
OrthoInspector 1 1.000 - - otm47203
orthoMCL 1 0.900 - - OOG6_102000
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2155
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.