DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and atp6v0ca

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001098606.2 Gene:atp6v0ca / 192336 ZFINID:ZDB-GENE-020419-23 Length:154 Species:Danio rerio


Alignment Length:165 Identity:57/165 - (34%)
Similarity:86/165 - (52%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TSNPF---LWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYG 108
            |.||.   .::.||...|...|.||||.|....|..:|...|..|.:..|::|.|:....:||||
Zfish     3 TQNPQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYG 67

  Fly   109 LITAILLSGNV-NKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALA 172
            |:.|:|::.|: :|.|              ::..|...||||.||:..:|.|.|:||||......
Zfish    68 LVVAVLIANNIGDKIS--------------LYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRG 118

  Fly   173 DAANSALFVKILIVEIFGSAIGLFGLIVAIYMTSK 207
            .|....|||.::::.||...:||:|||||:.:::|
Zfish   119 TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 38/110 (35%)
ATP-synt_C 143..204 CDD:278563 26/60 (43%)
atp6v0caNP_001098606.2 V_ATP_synt_C 11..116 CDD:130170 40/118 (34%)
PRK14893 12..154 CDD:184887 54/156 (35%)
ATP-synt_C 90..151 CDD:278563 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.