DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaPPA1-2 and vha-3

DIOPT Version :9

Sequence 1:NP_650406.2 Gene:VhaPPA1-2 / 41806 FlyBaseID:FBgn0262514 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001367642.1 Gene:vha-3 / 177018 WormBaseID:WBGene00006912 Length:161 Species:Caenorhabditis elegans


Alignment Length:155 Identity:52/155 - (33%)
Similarity:77/155 - (49%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PFLWSGMGIFLACALSVLGAASGIYMIGCSVAGGGVRSPRIKTKNLISVIFCEAVAIYGLITAIL 114
            || :..||...|...:|||||.|.......:...||..|.:..|::|.||....:.||||:.|::
 Worm    15 PF-FGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMV 78

  Fly   115 LSGNVNKFSSVRLITDSTVMATNMFTGFATFGAGLCVGMVNVACGIAVGIVGSGAALADAANSAL 179
            |.|.|...|:          ..::..|||...|||..|:..:..|.|:||||.......|....|
 Worm    79 LKGKVTSASA----------GYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRL 133

  Fly   180 FVKILIVEIFGSAIGLFGLIVAIYM 204
            ||.::::.||...:||:|:|||:.:
 Worm   134 FVGMILILIFSEVLGLYGMIVALIL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaPPA1-2NP_650406.2 ATP-synt_C 56..166 CDD:294318 36/109 (33%)
ATP-synt_C 143..204 CDD:278563 23/60 (38%)
vha-3NP_001367642.1 V_ATP_synt_C 16..124 CDD:130170 39/118 (33%)
ATP-synt_Vo_c_ATP6C_rpt2 92..158 CDD:349416 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.